PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.17JE2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family MYB_related
Protein Properties Length: 267aa    MW: 29928 Da    PI: 7.164
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.17JE2genomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.81.6e-152873148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg++T  E++ ++++ ++lG++ W++Ia++++  Rt++++k++w+++l
      Aradu.17JE2 28 RGNFTDHEEKMIIHLQALLGNR-WAAIASYLP-QRTDNDIKNYWNTHL 73
                     89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500904.426122IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.602.3E-10833IPR009057Homeodomain-like
SuperFamilySSF466893.55E-21880IPR009057Homeodomain-like
PROSITE profilePS5129423.512377IPR017930Myb domain
SMARTSM007174.0E-152775IPR001005SANT/Myb domain
PfamPF002496.2E-142873IPR001005SANT/Myb domain
CDDcd001673.81E-103073No hitNo description
Gene3DG3DSA:1.10.10.601.7E-203477IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 267 aa     Download sequence    Send to blast
MCNFLGLMRC SKSCRLRWTN YLRPGIKRGN FTDHEEKMII HLQALLGNRW AAIASYLPQR  60
TDNDIKNYWN THLKKKLAKN QSGAAEDGGD YQDGNSSRSQ PKGQWERRLQ TDIHMAKQAL  120
SEALSLSKSS NNNNNVLSES SSSYDASKFV TRTSHAASSS SSSYASSYEN ISKLLENWMK  180
SPNSCAEMTT NSGNSFSSNN SEADHGFDSL LSFKSDDERK PKYLSSSEAQ QQVPLTLLEK  240
WLFDDGAAQC HEDLMNMSLE ESTSGLF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-1897740108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015946745.10.0PREDICTED: myb-related protein 306-like
SwissprotP813921e-77MYB06_ANTMA; Myb-related protein 306
TrEMBLA0A0D4D9831e-114A0A0D4D983_9FABA; MYBJ2
STRINGGLYMA04G33720.11e-103(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF101634115
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47600.14e-62myb domain protein 94